PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009616295.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 366aa    MW: 41060.3 Da    PI: 7.0518
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009616295.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+++++  g+ R++k+c++rw +yl
   XP_009616295.1 14 RGLWSPEEDEKLIKYITTYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding46.49.4e-1567109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+++ +E  l+++++  lG++ W+ Ia++++ gRt++++k++w+
   XP_009616295.1  67 RGSFSHQEAALIIELHSILGNR-WAQIAKHLP-GRTDNEVKNFWN 109
                      899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-27564IPR009057Homeodomain-like
PROSITE profilePS5129425965IPR017930Myb domain
SuperFamilySSF466894.49E-2911108IPR009057Homeodomain-like
SMARTSM007178.3E-141363IPR001005SANT/Myb domain
PfamPF002497.0E-161461IPR001005SANT/Myb domain
CDDcd001672.80E-121761No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2465116IPR009057Homeodomain-like
SMARTSM007171.0E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129420.00266116IPR017930Myb domain
PfamPF002491.6E-1367110IPR001005SANT/Myb domain
CDDcd001671.57E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MGHHTCCNKQ KVKRGLWSPE EDEKLIKYIT TYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SHQEAALIIE LHSILGNRWA QIAKHLPGRT DNEVKNFWNS SIKKKLLSHG  120
TLSDFSMIFP NNLTTTNPNP SFENFYPLNS TPINFMPIST NSPLILQVDH QMNNNHLNGD  180
LNLNPVVPSL INPLSFDSIT NDPTWVNFNY PHPQHDLDNY NQNVLIQGNS DSMLTSNISL  240
NYTNGENFMD SRNADIKTHQ DLLMVSLLPK LSEMIKGNGG IVESSPPAAS QQIESMVVSS  300
LPCTFPNGYI HPHFGMNGVY EMEQIECMHM SSNFPSSSSP SSSKSSPSSC NTQFMMNPSL  360
PTSWDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616295.10.0PREDICTED: transcription factor MYB86-like isoform X2
RefseqXP_016501060.10.0PREDICTED: transcription factor MYB26-like isoform X2
TrEMBLK4BMX31e-143K4BMX3_SOLLC; Uncharacterized protein
STRINGSolyc03g121740.1.11e-143(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.26e-79myb domain protein 26